PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn138821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 135aa    MW: 14846.8 Da    PI: 10.4679
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn138821genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-073341647
                     HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +++G+g+W+ I+r +   +t+ q+ s+ qky
       Achn138821  3 LEKHGKGDWRNISRNFVVSKTPTQVASHAQKY 34
                     68***************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.378139IPR017930Myb domain
SuperFamilySSF466895.28E-8239IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-5233IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-9238IPR006447Myb domain, plants
CDDcd001679.42E-5235No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MGLEKHGKGD WRNISRNFVV SKTPTQVASH AQKYFIRQNS GGKDKRRPSI HDITAVHLVE  60
PTPSSDGDSP SQKSPVTSTM VLNWAQPNDG AVMVFGSTHV NPFLQYKYEI ASHGLKLQRS  120
AHLGTLNSLF QSMM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275014.12e-47PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-36DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLF6HNL82e-47F6HNL8_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g03370.t017e-47(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1644955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.18e-32Homeodomain-like transcriptional regulator